GOMAP-Singularity ISSUE

[mmtohm]

Hi, I ran this command "./run-GOMAP-SINGLE.sh --step=seqsim --config=test/config.yml" on PBS script
and error file show this : "The input sequences contain non IUPAC amino acid characters"

How to fix it?
This is my sequence

TRINITY_DN0_c0_g1_i101.p5 TRINITY_DN0_c0_g1~~TRINITY_DN0_c0_g1_i101.p5 ORF type:complete len:128 (+),score=3.74 TRINITY_DN0_c0_g1_i101:3043-3426(+)
MNQMHFFFSNRYGVTQIITISATHVLYRLFSPFPPSLHLECYSTTNHCRALQAQGNFLAQVNKKILSFFCCIKPHTPIHFCTYRLDFLGGKFNETANISDVSVEKCANGNSFLLFVWITVSLVLINL*

[wkpalan]

You will have to remove the * character at the end of the sequences

…

On Tue, Feb 28, 2023, 2:15 PM mmtohm ***@***.***> wrote: Hi, I ran this command "./run-GOMAP-SINGLE.sh --step=seqsim --config=test/config.yml" on PBS script and error file show this : "The input sequences contain non IUPAC amino acid characters" How to fix it? This is my sequence TRINITY_DN0_c0_g1_i101.p5 TRINITY_DN0_c0_g1~~TRINITY_DN0_c0_g1_i101.p5 ORF type:complete len:128 (+),score=3.74 TRINITY_DN0_c0_g1_i101:3043-3426(+) MNQMHFFFSNRYGVTQIITISATHVLYRLFSPFPPSLHLECYSTTNHCRALQAQGNFLAQVNKKILSFFCCIKPHTPIHFCTYRLDFLGGKFNETANISDVSVEKCANGNSFLLFVWITVSLVLINL* — Reply to this email directly, view it on GitHub <#29>, or unsubscribe <https://github.com/notifications/unsubscribe-auth/ABQPFNSM2EFFR6DLUPYQCY3WZZFGBANCNFSM6AAAAAAVLD57KQ> . You are receiving this because you are subscribed to this thread.Message ID: ***@***.***>

[mmtohm]

How to remove the * character at the end of the sequences