Are the "designed" structures of the submissions available?

[RodenLuo]

Hi again,

Using the sequence from this submission (https://foundry.adaptyvbio.com/competition?design=00383d74-8a5d-4c02-9b91-3e6baf983ed5), and the full sequence from the "Sequence / Epitope*" section at https://design.adaptyvbio.com/, to predict the binder-target complex in AlphaFold3, I believe I get a structure indicating the binder is interacting at a different site than the one shown on the web.

Using the following shortened target sequence (which has only the intended interacting domain), I get a structure I believe is more similar to the shown one. See the screenshot below.

PCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCR

I thus wonder:

1. Are the "designed" structures of the submissions available?
2. What is the structure shown on the web? Can we download them somewhere?

Thanks