Skip to content

Open-Athena/MarinFold

Repository files navigation

MarinFold

Open In Colab Open in Kaggle

Can a vanilla LLM predict protein structures (e.g. contact maps, inter-residue distances) without MSAs or PLMs? MarinFold aims to answer this question. Our models are trained from scratch (without natural language data) on Marin infrastructure.

This is a research codebase for an ongoing project. It is an experiment in open development.

We welcome collaborators! If you would like to discuss or contribute, join the Marin Discord and look for the #marinfold channel.

Current performance

Here we are prompting with the amino acid sequence and predicting residue/residue contacts.

Contact R-precision: MarinFold #61 n=100 rollouts vs Protenix-v2 / ESMFold / ESMFold2 (n=554)

The MarinFold #61 n=100 rollouts bar above is our #61 model (eval loss 2.76) with our best test-time inference — 100 resampled rollouts with pairwise tie-breaking (see exp82).

Try it out

Our current best model predicts a residue–residue contact map from a single sequence — no MSA, no template, no structure. It's the contacts-v1 1.5B model @eric-czech trained in #61 (the MarinFold #61 n=100 rollouts predictor in Current performance above) and is the default model in MODELS.yaml.

GPU example

Set up:

# Install uv if you don't already have it:
curl -LsSf https://astral.sh/uv/install.sh | sh

git clone https://github.com/Open-Athena/MarinFold.git
cd MarinFold/marinfold
uv sync --extra vllm  # "vllm" for Linux+GPU, "transformers" for CPU/CUDA, "mlx" for Apple Silicon

Run inference:

# Predict the contact map for the Top7 de novo designed protein ([1QYS](https://www.rcsb.org/structure/1QYS)).
# Replace "vllm" with "transformers" (CPU/CUDA) or "mlx" (Apple Silicon).
SEQUENCE=MGDIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQLEGGSLEHHHHHH
uv run marinfold infer \
    --backend vllm \
    --input-sequence $SEQUENCE \
    --out ~/prediction.json \
    --out-plots ~/contact_map.pdf

--out holds one P(contact) score per residue pair; --out-plots is the contact-map heatmap. The first run downloads our 1.5B contacts-v1 model (~6 gb). Omitting --model uses the default (contacts-v1-exp75-1.5B); the older distogram models are still available as --model 1B / 1.5B (see below).

The command above uses the fast pairwise readout (~0.3 s/protein). Our best inference — the MarinFold #61 n=100 rollouts bar in Current performance — is exp82's rollout recipe: vote over 100 sampled contact-section completions (each from a freshly resampled document) with a pairwise tie-break. It is ~150× slower (~50 s/protein on a GPU) but sharpens the top-ranked contacts. Run it via the per-impl driver (the top-level CLI keeps its surface narrow):

uv run contacts-v1 infer \
    --backend vllm --model contacts-v1-exp75-1.5B \
    --method rollout --n-rollouts 100 \
    --input-sequence $SEQUENCE \
    --out ~/prediction.json --out-plots ~/contact_map.pdf

rollout needs a sampling backend — --backend vllm or transformers (not mlx). The pairwise --ensemble-k N test-time-augmentation knob lives on this driver too.

To score against a known structure's ground-truth contacts, use evaluate (reports contact-prediction AUC and precision@{L, L/2, L/5}). Ground truth is read with pyconfind, so add its extra to the sync (uv sync --extra vllm --extra contacts-v1):

uv run marinfold evaluate \
    --backend vllm \
    --input tests/data/1QYS.cif \
    --metrics-out ~/metrics.json \
    --out-plots ~/gt_vs_pred.pdf

Previous generation (distograms)

Our earlier contacts-and-distances-v1 models predict CB–CB distograms rather than contacts. Same CLI, just point --model at one of them:

uv run marinfold infer \
    --backend vllm --model 1B \
    --input-sequence $SEQUENCE \
    --out ~/distogram.json --out-plots ~/distogram.pdf

Document structures

A document structure is a recipe for turning a protein structure into the token string a trained model sees (and back). contacts-and-distances-v1 is our current format: a residue sequence followed by a mix of CB-CB contact statements and per-pair distance statements, with a per-structure pLDDT-bin token.

Generate one document from a structure file:

cd marinfold
uv sync
uv run contacts-and-distances-v1 generate \
    --input tests/data/1QYS.cif \
    --out /tmp/docs.jsonl

The output is one row per input structure with a document field holding the token string (.parquet works too — pick by suffix). View the first document:

python -c "import json; print(json.loads(open('/tmp/docs.jsonl').readline())['document'])"

You'll see a single space-separated token string like:

<contacts-and-distances-v1> <begin_sequence> <M> <G> <D> <I> ... <begin_statements> <long-range-contact> <p3> <p82> <distance> <p7> <p41> <CA> <CB> <d12.5> ... <plddt_95_100> <end>

Point --input at a directory to batch over a whole set of structures (one document per input). See contacts-and-distances-v1 generate --help for the algorithm knobs (contact cutoff, per-mode fractions, pLDDT filter, context-length budget).

A second format, contacts-v1 (SPEC.md), is contacts-only: a residue sequence — <pN> <AA> statements in random order, with <n-term>/<c-term> markers and residues numbered from a random start that wraps around 2000 indices — followed by <contact> statements for the strongest pyconfind side-chain contacts above a minimum degree (as many as fill the context budget), listed in random order. Generation needs the contacts-v1 extra (pyconfind):

cd marinfold
uv sync --extra contacts-v1
# Eyeball documents + their contact tables in the terminal:
uv run contacts-v1 view --input tests/data/1QYS.cif
# Write documents (with protein-docs-style metadata columns) plus a
# per-protein JSON summary (sequence, every contact's degree, truncation):
uv run contacts-v1 generate --input tests/data/1QYS.cif \
    --out /tmp/contacts_v1_docs.jsonl --summary-out /tmp/summary.json

More details (mostly written by robots)

Trained models are listed in [MODELS.yaml](MODELS.yaml) by nickname. The marinfold CLI looks up the model, picks the first document structure it supports, and dispatches to the graduated impl. Two subcommands:

cd marinfold
uv sync --extra mlx        # or --extra vllm, or --extra transformers

# Predict structure for a sequence (contacts or distances, per the model).
uv run marinfold infer \
    --backend mlx --input-sequence SIINFEKLLLSKP \
    --out /tmp/preds.json

# Evaluate predictions against ground-truth structures.
uv run marinfold evaluate \
    --backend mlx --input /path/to/pdbs/ \
    --metrics-out /tmp/metrics.json
Backend Platform Extra
vllm Linux + NVIDIA GPU (production / scaled eval) --extra vllm
mlx Apple Silicon (fastest local) --extra mlx
transformers Anywhere torch installs (Apple MPS, CPU, CUDA) --extra transformers

--model accepts a [MODELS.yaml](MODELS.yaml) nickname or a local checkpoint directory. Omit it to use the entry marked default: true. --document-structure overrides the impl selection; without it the first supported impl wins. See [marinfold/README.md](marinfold/README.md) for the full backend matrix and marinfold infer --help / marinfold evaluate --help for the full flag set.

For impl-specific flags (seed-N sweeps, distance cap, batch size, etc.) each graduated impl ships its own lower-level CLI as a console script:

cd marinfold
uv sync --extra mlx
uv run contacts-and-distances-v1 evaluate \
    --backend mlx --model 1B \
    --input /path/to/pdbs/ --seed-n-values 0,5,20,50 \
    --out /tmp/metrics.json

Colab Notebooks

  • Inference Example 1 — run our current best contacts-v1-exp75-1.5B model on a structure from RCSB and plot the ground-truth vs predicted contact map (choose pairwise or rollout inference).
  • Inspect Data 1 — browse legacy timodonnell/protein-docs subsets plus newer open-athena/MarinFold bucket parquet data, with sample documents and parquet schema previews.

Layout

MarinFold/
├── MODELS.yaml             # registry of trained models (nickname → HF URL)
├── RESOURCES.md            # datasets, tokenizers, W&B projects, prior repos
├── AGENTS.md               # shared agent rules
├── .github/ISSUE_TEMPLATE/experiment.md
├── scripts/                # repo-management scripts (scaffold, itemize, history)
├── experiments/            # one dir per GitHub issue tagged `experiment`
│   ├── README.md
│   ├── AGENTS.md
│   ├── TEMPLATE.md
│   └── exp<N>_<kind>_<name>/       # individual experiments
├── marinfold/              # top-level package: backends, doc-structure toolkit, graduated impls, `marinfold` CLI
├── models/                 # library for model-training experiments
└── history/                # one file per W&B-logged run + summary RUNS.md

Each top-level dir under the repo root is a small library for one kind of work. Concrete experimental work begins as an issue and a sub-directory under experiments/ and may pull in helpers from the relevant library. Important / high-quality experiments get graduated — copied into the kind dir, where the copy keeps evolving while the original experiments/exp<N>_*/ stays frozen as the historical record.

Experiment workflow

  1. File an issue with the experiment label using the issue template. Specify the Kind: in the issue body.
  2. Scaffold the experiment dir:
 cd scripts
 uv sync                                                          # one-time setup
 python scaffold.py --issue <N> --kind <kind>

Creates experiments/exp<N>_<kind>_<name>/ with a README pre-filled from the issue body. 3. Implement. Add .py files in the experiment dir. If the experiment imports marin, add a pyproject.toml declaring a path dep on the relevant kind library; see [exp0_models_protein_docs_initial_port/pyproject.toml](experiments/exp0_models_protein_docs_initial_port/pyproject.toml) as the worked example. 4. Launch. Marin's executor hash-caches step outputs, so a rerun with no config changes is a no-op: 5. Record results in the experiment's README. Commit small CSVs to its data/, plots to its plots/. Large artifacts go to GCS or HuggingFace (see below). 6. Regenerate the index: python scripts/itemize.py. 7. Close the issue once the conclusion lands.

Most work happens on main. Use a branch (exp/<N>-<name>) only when an experiment needs speculative changes to a shared kind library.

Experiment kinds

Every experiment is one of four kinds, indicated by the second token in its directory name (exp10_<kind>_<name>):

Kind What it does Library lives in
models Train models [models/](models/)
evals Run evals on trained models — (no shared library yet)
data Generate training / eval datasets — (no shared library yet)
document_structures Define a generate-from-input + evaluate-against-ground-truth interface for one protein-document format [marinfold/marinfold/document_structures/](marinfold/marinfold/document_structures/)

Kind libraries are only created when a second experiment needs the same helper. Today evals/ and data/ kinds exist as experiment kinds (e.g. experiments/exp9_evals_*) but have no shared library — the first experiment in each kind that finds itself sharing code with a sibling creates the kind dir at that point.

A document structure is a recipe with two responsibilities: turn input data (e.g. a PDB) into a training document string, and score a trained model against ground-truth structures using the same format. Each format is a self-contained experiment dir with its own cli.py driver (generate / infer / evaluate / tokenizer subcommands) on top of the shared toolkit in [marinfold.document_structures](marinfold/marinfold/document_structures/) (EvalResult, build_tokenizer, parquet/jsonl writers). The reference impl is [experiments/exp1_document_structures_contacts_and_distances_v1/](experiments/exp1_document_structures_contacts_and_distances_v1/); graduated impls live as subpackages of marinfold.document_structures.

Graduating an experiment

When an experiment's results are validated and the code should keep evolving as a first-class object, copy the directory into the matching kind dir, dropping the exp<N>_<kind>_ prefix:

# models / evals / data: peer kind directory
cp -r experiments/exp<N>_<kind>_<name>/ <kind>/<name>/
# e.g. cp -r experiments/exp42_models_protein_1b/ models/protein_1b/

# document_structures: subpackage of marinfold
cp -r experiments/exp<N>_document_structures_<name>/ \
      marinfold/marinfold/document_structures/<name>/

The original experiments/exp<N>_*/ directory stays frozen as the historical record — the README, data, plots, and conclusion remain as they were at the time of the experiment. The graduated copy is the working version going forward; edits land there.

After the copy: convert sibling imports to intra-package relative imports (from .vocab import …), add an __init__.py re-export of the public surface, and — for document_structures impls — add an optional-deps extra to marinfold/pyproject.toml for any heavy parser deps (e.g. gemmi). Tests move next to similar tests under each kind dir's tests/.

Run history

Every W&B-logged run gets a markdown file under history/runs/. A run is anything with a W&B link — training, evals, data-gen pipelines that emit metrics. Multiple processes contributing to the same W&B run_id share one history file.

Each file has YAML frontmatter (user, launch time, W&B URL, iris job IDs, git SHA, kind, experiment, short description) plus a free-form body for the detailed plan, changes from prior runs, and notes. history/RUNS.md is a generated summary table sorted newest- first with links out to W&B + the detail file.

After wandb.init() returns and you have the W&B URL in hand:

python scripts/history.py new \
    --wandb-url https://wandb.ai/open-athena/MarinFold/runs/<id> \
    --wandb-name <display-name> \
    --experiment exp<N>_<kind>_<name>   # or no_experiment
    --kind <models|evals|data|document_structures|other> \
    --short "<one-line description>" \
    --iris-jobs <iris-job-id>

python scripts/history.py add-iris-job <run-stem> <new-iris-job-id>   # on preempt-restart
python scripts/history.py update-index                                # regenerate RUNS.md
python scripts/history.py sync                                        # catch missed runs (needs wandb extra)
python scripts/history.py check                                       # CI gate

See [history/README.md](history/README.md) for the full schema and policy.

Where artifacts go

We try hard to avoid committing large files into the repo. The authoritative homes for non-source artifacts:

  • HuggingFace bucket (buckets/open-athena/MarinFold) — single bucket for both data artifacts and model checkpoints. Inside, use top-level data/... and checkpoints/... prefixes so the distinction is explicit. Checkpoint names should embed the W&B run name. (See AGENTS.md "HF bucket" for the splitting policy.)
  • HuggingFace datasets (huggingface.co/datasets/timodonnell/<name>) — first-class published text / tokenized corpora that levanter loads via hf://datasets/ URIs. Long-tail / in-flight data artifacts go to the bucket instead.
  • GCS (gs://marin-<region>/<...>, co-located with the job's compute zone — see AGENTS.md "GCS bucket") — large intermediate artifacts produced by marin's executor (tokenized parquets, cached features, predictions).
  • W&B (https://wandb.ai/open-athena/MarinFold) — training and eval metrics, run metadata.

The repo holds source, prose, small CSVs that feed plots, and plots themselves. Anything bigger than ~1 MB needs a deliberate reason to be checked in.

Tooling reference

Repo-management scripts live in [scripts/](scripts/) and are run with plain python:

Script Purpose
python scripts/scaffold.py --issue N --kind K Create an experiment dir from a GitHub issue
python scripts/itemize.py Regenerate experiments/index.md
python scripts/history.py new ... Create a run history file for a W&B run
python scripts/history.py add-iris-job ... Append an iris job ID (preemption / restart)
python scripts/history.py sync Pull W&B runs; skeleton-file the missing ones (needs wandb extra)
python scripts/history.py update-index Regenerate history/RUNS.md
python scripts/history.py check CI gate: exit non-zero if W&B has runs without history files

For impl-specific CLI surfaces (e.g. generate and tokenizer subcommands), see the per-impl console script — graduated impls expose one as <structure-name> (e.g. contacts-and-distances-v1 {generate,infer,evaluate,tokenizer} ...) installed alongside the top-level marinfold command.

To set up the scripts venv: cd scripts && uv venv --python 3.11 && uv sync (add --extra wandb for history sync / history check).

Status

Initial port (commit-level) from the [marin/protein-training-1b](https://github.com/marin-community/marin/tree/protein-training-1b/experiments/protein) branch. All training/export scripts live under [experiments/exp0_models_protein_docs_initial_port/](experiments/exp0_models_protein_docs_initial_port/); shared marin glue is in [models/marinfold_models/](models/marinfold_models/). The contacts-and-distances-v1 document structure is graduated at [marinfold/marinfold/document_structures/contacts_and_distances_v1/](marinfold/marinfold/document_structures/contacts_and_distances_v1/); its in-flight history lives at [experiments/exp1_document_structures_contacts_and_distances_v1/](experiments/exp1_document_structures_contacts_and_distances_v1/). Eval experiments (e.g. experiments/exp9_evals_*) have started landing; a shared evals kind library will be created when a second eval experiment needs the same helper.

About

Protein structure via next token prediction

Resources

License

Stars

7 stars

Watchers

0 watching

Forks

Releases

No releases published

Packages

 
 
 

Contributors