Skip to content

lignum-vitae/biobase

Folders and files

NameName
Last commit message
Last commit date

Latest commit

 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

Biobase

Static Badge Python Version from PEP 621 TOML PyPI version License: MIT GitHub branch check runs

A Python package providing standardized biological constants and substitution matrices for bioinformatics pipelines. Biobase aims to eliminate the need to repeatedly recreate common biological data structures and scoring systems in your code.

Table of Contents

Quick Start

Access amino acid properties

from biobase.constants import ONE_LETTER_CODES, MONO_MASS, CODON_TABLE
print(ONE_LETTER_CODES)      # 'ACDEFGHIKLMNPQRSTVWY'
print(MONO_MASS['A'])        # 71.037113805
print(CODON_TABLE["AUG"])    # M

Use substitution matrices

from biobase.matrix import Blosum
blosum62 = Blosum(62)
print(blosum62['A']['A'])  # 4
print(blosum62['W']['C'])  # -2
from biobase.matrix import Pam
pam200 = Pam(200)
print(pam200['A']['A'])  # 3
print(pam200['W']['C'])  # -9
from biobase.matrix import Identity
identity0 = Identity(0)
print(identity0['A']['A'])  # 1
print(identity0['W']['C'])  # 0
from biobase.matrix import Match
match_mat = Match()
print(match_mat['A']['A'])  # 1
print(match_mat['W']['C'])  # -1

Analyse DNA sequences

from biobase.analysis import Dna
sequence = "ATCGTAGC"
print(Dna.complement(sequence))               # 'TAGCATCG'
print(Dna.complement(sequence, reverse=True)) # 'GCTACGAT'
print(Dna.transcribe(sequence))               # 'AUCGUAGC'
print(Dna.translate(sequence))                # 'IV'
print(Dna.calculate_gc_content(sequence))     # 50.0
print(Dna.calculate_at_content(sequence))     # 50.0
print(Dna.entropy(sequence))                  # 2.0

seq = "ccatgccctaaatggggtag"
for start, end, orf in Dna.find_orfs(seq, include_seq=True)
    print(start, end, orf)
# 2, 11, "ATGCCCTAA"
# 11, 20, "ATGGGGTAG"

Analyse Nucleotides

from biobase.analysis import Nucleotides

print(Nucleotides.molecular_weight("A"))               # 135.13
print(Nucleotides.cumulative_molecular_weight("ATCG")) # 523.48
print(Nucleotides.translate("AUGUUGUCGCCUU"))          # 'MLSP'

Find protein motifs

from biobase.analysis import find_motifs
sequence = "ACDEFGHIKLMNPQRSTVWY"
print(find_motifs(sequence, "DEF"))
# [(1, 4)]

test_dict = {
    ">SP001": "ACDEFCDEFCDEFGHIKLMN",  # has matches for "CDE" that span indexes [(1, 4), (5, 8), (9, 12)]
    ">SP002": "MNPQRSTVWYACDEFGHIKL",  # has match for "CDE" that span indexes [(11, 14)]
    ">SP003": "AAAAAAAAAAAAAAAAAA12",  # invalid: contains "1", "2"
    ">SP004": "GGGGGGGGGGGGGGGGGGGG",  # no match
    ">SP005": "HHHHHHHHHHHHHHHHH@#$",  # invalid: contains "@", "#", "$"
    ">SP006": "DDDDDDDDDDDDDDDDDDDD",  # no match
    ">SP007": "CDEFGHCDEFKLCDEFPQRS",  # has matches for "CDE" that span indexes [(0, 3), (6, 9), (12, 15)]
    ">SP008": "LLLLLLLLLLLLLLLLLLLL",  # no match
    ">SP009": "KKKKKKKKKKKK123KKKKK",  # invalid: contains "1", "2", "3"
    ">SP010": "CDEACDEDCDEFAAAAAAAA",  # has matches for "CDE" that span indexes [(0, 3), (4, 7), (8, 11)]
}
matched, invalid, non_match = find_motifs(test_dict, "CDE")
print("Matches:")
for seq, matches in matched.items():
    print(f"{seq}")
    print(f"{"".join([f"{match[0]} to {match[1]}\n" for match in matches])}")
print(f"Invalid sequences:\n{"".join([f"{seq}: {invs}\n" for seq, invs in invalid.items()])}")
print(f"Sequences without matches:\n{"".join([f"- {nm}\n" for nm in non_match])}")

# Matches:
# >SP001
# 1 to 4
# 5 to 8
# 9 to 12

# >SP002
# 11 to 14

# >SP007
# 0 to 3
# 6 to 9
# 12 to 15

# >SP010
# 0 to 3
# 4 to 7
# 8 to 11

# Invalid sequences:
# >SP003: {'2', '1'}
# >SP005: {'$', '@', '#'}
# >SP009: {'2', '1', '3'}

# Sequences without matches:
# - >SP004
# - >SP006
# - >SP008

Parse FASTA

from biobase.parser import FastaParser, fasta_parser
fasta = """>CAA39742.1 cytochrome b (mitochondrion) [Sus scrofa]
MTNIRKSHPLMKIINNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHIC"""

# Class that yields generator
records = list(FastaParser(fasta))
r: FastaRecord = records[0]
print(r.id) # CAA39742.1
print(r.seq) # MTNIRKSHPLMKIINNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHIC

# Function that returns list
records = fasta_parser(fasta)
for r in records:
    print(r.id) # CAA39742.1
    print(r.seq) # MTNIRKSHPLMKIINNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHIC

Parse FASTQ

from biobase.parser import FastqParser, fastq_parser
fastq = """@2fa9ee19-5c51-4281-abdd-eac86
CGGTAGCCAGCTGCGTTCAGTATG
+
%%%+++'''@@@???<<<??????"""

# Class that yields generator
records = list(FastqParser(fastq))
r: FastqRecord = records[0]
print(r.id) # 2fa9ee19-5c51-4281-abdd-eac86
print(r.seq) # CGGTAGCCAGCTGCGTTCAGTATG

# Function that returns list
records = fastq_parser(fastq)
for r in records:
    print(r.id) # 2fa9ee19-5c51-4281-abdd-eac86
    print(r.seq) # CGGTAGCCAGCTGCGTTCAGTATG

Requirements

  • Python 3.10+
  • pip (for installation)

Installation

Regular Installation

pip install biobase

Development Installation

Clone the repository and install in editable mode:

git clone https://github.com/lignum-vitae/biobase.git
cd biobase
uv pip install -e ".[dev]"

Files can be run using uv run <file_name> if in the same directory/folder as the file.

If not using uv, to ensure that relative imports correctly work, run files using the module path from the project root. To run the sub_matrix file, use the command python -m src.biobase.matrix.sub_matrix

Data Files

  • src/biobase/matrices/: Scoring matrix data stored in JSON file format

Project Goals

Biobase aims to provide Python-friendly versions of common biological constants and tools for bioinformatics pipelines. Key objectives:

  1. Standardize biological data structures
  2. Provide efficient implementations of common scoring systems
  3. Ensure type safety and validation
  4. Maintain comprehensive documentation
  5. Support modern Python practices

Contributing

We welcome contributions! Please read our:

Stability

This project is in the beta stage. APIs may change without warning until version 1.0.0.

License

This project is licensed under the MIT License - see the LICENSE file for details.